PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g102980.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 291aa    MW: 32601 Da    PI: 7.9248
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g102980.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.62.6e-3264119359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                          vrYkeClkNhAas+Gg+a+DGCgEfmps geegt++al C+AC+CHRnFHR+eve 
  Sopim01g102980.0.1  64 IVRYKECLKNHAASMGGNATDGCGEFMPS-GEEGTIEALICSACNCHRNFHRKEVEG 119
                         68**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.9E-2965117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2565127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-3166117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.36667116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.69E-18203276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-30210277IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-26215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MELPSQDHED MPIPINSTYG HLIHHDPTPP NNTNHIIPPS MNGPPIDAPP VATAADHHVP  60
FKKIVRYKEC LKNHAASMGG NATDGCGEFM PSGEEGTIEA LICSACNCHR NFHRKEVEGD  120
QQQLASSCDC FHHVNNRVLG GGSTKKVYLG HNHHKTSLGP EPFGTIIPTR PPHHQMIMSY  180
NMGSLPNSES EEHDIQDHHH IGGIMGMARP LHHVKKRFRT KFTQEQKDKM LNFAEKVGWK  240
IQKQEEGVVQ QFCQEVGVKR RVLKVWMHNN KHSLAKKNIT TNIPNENQLP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242162731875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230410.10.0PREDICTED: zinc-finger homeodomain protein 4
SwissprotQ9M9S02e-75ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLK4B1M40.0K4B1M4_SOLLC; Uncharacterized protein
STRINGSolyc01g102980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-73homeobox protein 31